(data stored in ACNUC7421 zone)

EMBL: CP001600.PE189

CP001600.PE189       Location/Qualifiers
FT   CDS             complement(220494..222065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0215"
FT                   /product="maltose transport system permease protein MalF,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67458"
FT                   /db_xref="GOA:C5B6Z6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z6"
FT                   /protein_id="ACR67458.1"
FT                   /translation="MSLSQTEYPASEPRQLYPRTGLKWLAVSLLTLLTGYLTIVMYAQG
FT                   EYLFAMLTLILLGGGLYIFANRRAYAWRYVYPGLAGMGLFVLFPLICTIAIAFTNYSST
FT                   NQLSQERAQSVLLQRLFTSGQTYTFSLYPDGGQWRLQLTDAQSGQRYLSGPFNLSQPDL
FT                   QISMAVADSASQGSAATLRTVTQHRQTLNSLVALLPDGTALRMSSLRQFAASRPLYTLG
FT                   DDGRTLTDNQSGIAYRPNMQSGFYQAVNADGNWRSERLSPGFTVTTGWKNFLRVLNDEG
FT                   IRQPFISIFIWTLLFSVLTVIFTVAVGMVLACVVQWEALRGRAAYRVLLILPYAVPAFI
FT                   SILIFKGLFNQSFGEINMMLSQLFGIRPAWFSDPLTAKCMILIVNTWLGYPYMMILCMG
FT                   LLKAIPEDLYEASAMDGAGPLQNFFRITLPMLIKPLTPLMIASFAFNFNNFVLIQLLTN
FT                   GGPDMLGTSTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAILNLKA
FT                   SKMNFD"
     MSLSQTEYPA SEPRQLYPRT GLKWLAVSLL TLLTGYLTIV MYAQGEYLFA MLTLILLGGG        60
     LYIFANRRAY AWRYVYPGLA GMGLFVLFPL ICTIAIAFTN YSSTNQLSQE RAQSVLLQRL       120
     FTSGQTYTFS LYPDGGQWRL QLTDAQSGQR YLSGPFNLSQ PDLQISMAVA DSASQGSAAT       180
     LRTVTQHRQT LNSLVALLPD GTALRMSSLR QFAASRPLYT LGDDGRTLTD NQSGIAYRPN       240
     MQSGFYQAVN ADGNWRSERL SPGFTVTTGW KNFLRVLNDE GIRQPFISIF IWTLLFSVLT       300
     VIFTVAVGMV LACVVQWEAL RGRAAYRVLL ILPYAVPAFI SILIFKGLFN QSFGEINMML       360
     SQLFGIRPAW FSDPLTAKCM ILIVNTWLGY PYMMILCMGL LKAIPEDLYE ASAMDGAGPL       420
     QNFFRITLPM LIKPLTPLMI ASFAFNFNNF VLIQLLTNGG PDMLGTSTPA GYTDLLVSYT       480
     YRIAFEGGGG QDFGLAAAIA TLIFLLVGAL AILNLKASKM NFD                         523
//

If you have problems or comments...

PBIL Back to PBIL home page