(data stored in ACNUC7421 zone)

EMBL: CP001600.PE190

CP001600.PE190       Location/Qualifiers
FT   CDS             complement(222203..223396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0216"
FT                   /product="maltose-binding periplasmic protein precursor,
FT                   MalE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67459"
FT                   /db_xref="GOA:C5B6Z7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z7"
FT                   /protein_id="ACR67459.1"
FT                   /translation="MTKTSTIKTIALSALAALVIAAPALAKIEEGKLVIWINGDKGYNG
FT                   LADVGKKFEQETGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAE
FT                   VHPSKAFQEKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPTPPRSWEEIPALDS
FT                   KLRAQGKSAIMWNLQEPYFTWPLIAADGGYAFKYVNGRYETNNVGVDNAGSRAGLQFLV
FT                   DMVKNKHINADTDYSIAEAAFNKGQTAMTINGPWAWSNIDKSGINYGITLLPTFKGQPS
FT                   KPFVGVLSAGINAASPNKELATEFIENYLLTDSGLAMVNRDKPLGAVALKSYQEILEKD
FT                   PRIAATMQNSQNGEIMPNIPQMSAFWYAERAAIINAINGRQSVTQALESAKERILKK"
     MTKTSTIKTI ALSALAALVI AAPALAKIEE GKLVIWINGD KGYNGLADVG KKFEQETGIK        60
     VTVEHPDKLE EKFPQVAATG DGPDIIFWAH DRFGGYAQSG LLAEVHPSKA FQEKLYPFTW       120
     DAVRYNGKLI AYPIAVEALS LIYNKDLLPT PPRSWEEIPA LDSKLRAQGK SAIMWNLQEP       180
     YFTWPLIAAD GGYAFKYVNG RYETNNVGVD NAGSRAGLQF LVDMVKNKHI NADTDYSIAE       240
     AAFNKGQTAM TINGPWAWSN IDKSGINYGI TLLPTFKGQP SKPFVGVLSA GINAASPNKE       300
     LATEFIENYL LTDSGLAMVN RDKPLGAVAL KSYQEILEKD PRIAATMQNS QNGEIMPNIP       360
     QMSAFWYAER AAIINAINGR QSVTQALESA KERILKK                                397
//

If you have problems or comments...

PBIL Back to PBIL home page