(data stored in ACNUC7421 zone)

EMBL: CP001600.PE193

CP001600.PE193       Location/Qualifiers
FT   CDS             223882..224991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0219"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67462"
FT                   /db_xref="GOA:C5B700"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B700"
FT                   /protein_id="ACR67462.1"
FT                   /translation="MANVSLRNVYKAYGEAVISRDINLDIEDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELQIAGVRMNEVPPAKRGIGMVFQSYALYPHLSVADNMSFGLKLAG
FT                   VSKAEIQQRVNQVAETLQLAHLLDRRPKALSGGQRQRVAIGRTLVAEPDVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLQRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLALY
FT                   HYPADRFVAGFIGSPKMNFLPVKVSEAQPQRVQVELPNGQHIWLPVAGEGLRPGSNLSL
FT                   GIRPEHLVPSAAADVTLSGEVQVVEQLGNETQIHIQIPALRQNLVYRQNDVVLVDEGAT
FT                   LAIGLPAERCHLFREDGSACQRLYQEPGV"
     MANVSLRNVY KAYGEAVISR DINLDIEDGE FVVFVGPSGC GKSTLLRMIA GLEDITSGEL        60
     QIAGVRMNEV PPAKRGIGMV FQSYALYPHL SVADNMSFGL KLAGVSKAEI QQRVNQVAET       120
     LQLAHLLDRR PKALSGGQRQ RVAIGRTLVA EPDVFLLDEP LSNLDAALRV QMRIEISRLH       180
     KRLQRTMIYV THDQVEAMTL ADKIVVLDAG RVAQVGKPLA LYHYPADRFV AGFIGSPKMN       240
     FLPVKVSEAQ PQRVQVELPN GQHIWLPVAG EGLRPGSNLS LGIRPEHLVP SAAADVTLSG       300
     EVQVVEQLGN ETQIHIQIPA LRQNLVYRQN DVVLVDEGAT LAIGLPAERC HLFREDGSAC       360
     QRLYQEPGV                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page