(data stored in ACNUC7421 zone)

EMBL: CP001600.PE195

CP001600.PE195       Location/Qualifiers
FT   CDS             226437..227333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0221"
FT                   /product="maltose transport periplasmic protein family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67464"
FT                   /db_xref="GOA:C5B702"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:C5B702"
FT                   /protein_id="ACR67464.1"
FT                   /translation="MKIALNRLSRGVLLACALCCTPQAFADTLLPTDVAAAPELSHAAL
FT                   QALHWQPLTPPVDTTFTLGAESQTLAQGDIQGAVAALTLPANRGSLEITLSSRLHNKRL
FT                   YVPNVLVLDQHLRPAAYYPGSYFTYRQPGVMSGDRLEGTLKLTPVLGQQQIYLLIYTTR
FT                   QDLATTTRMVNPAKAYAAGVGNAVPDIPDPQAMHAPQGVLNIQARVERQSGNVMIGGLL
FT                   PTGDTPVDVAVGSPASTVAAPAAPMLDDTAAYFDRSIRSAVRQGDIDKALRLMNEAQRL
FT                   GSTTARETFIRSVKGKG"
     MKIALNRLSR GVLLACALCC TPQAFADTLL PTDVAAAPEL SHAALQALHW QPLTPPVDTT        60
     FTLGAESQTL AQGDIQGAVA ALTLPANRGS LEITLSSRLH NKRLYVPNVL VLDQHLRPAA       120
     YYPGSYFTYR QPGVMSGDRL EGTLKLTPVL GQQQIYLLIY TTRQDLATTT RMVNPAKAYA       180
     AGVGNAVPDI PDPQAMHAPQ GVLNIQARVE RQSGNVMIGG LLPTGDTPVD VAVGSPASTV       240
     AAPAAPMLDD TAAYFDRSIR SAVRQGDIDK ALRLMNEAQR LGSTTARETF IRSVKGKG         298
//

If you have problems or comments...

PBIL Back to PBIL home page