(data stored in ACNUC7421 zone)

EMBL: CP001600.PE200

CP001600.PE200       Location/Qualifiers
FT   CDS             233595..233957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0226"
FT                   /product="diacylglycerol kinase, putative"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67469"
FT                   /db_xref="GOA:C5B707"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:C5B707"
FT                   /protein_id="ACR67469.2"
FT                   /translation="MNSTTGLTRIIKAAGYSIKGLQAAWRHEAAFRQESLLLVVAVMLA
FT                   CWLDVTAVERILLIGSVTLVVILEILNSAIEAVVDRIGSERHELSGRAKDMGSAAVFVA
FT                   LWLALFVWVSILWTHL"
     MNSTTGLTRI IKAAGYSIKG LQAAWRHEAA FRQESLLLVV AVMLACWLDV TAVERILLIG        60
     SVTLVVILEI LNSAIEAVVD RIGSERHELS GRAKDMGSAA VFVALWLALF VWVSILWTHL       120
//

If you have problems or comments...

PBIL Back to PBIL home page