(data stored in ACNUC7421 zone)

EMBL: CP001600.PE206

CP001600.PE206       Location/Qualifiers
FT   CDS             complement(238510..239406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0232"
FT                   /product="citrate (pro-3S)-lyase, beta subunit, putative"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67475"
FT                   /db_xref="GOA:C5B713"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C5B713"
FT                   /protein_id="ACR67475.1"
FT                   /translation="MTPQQKTRTRRSMLFVPGANAAMLSNAFIYKADALMFDLEDSVVL
FT                   REKDAARRLVYHALQHPLYHDIETIVRVNALDSAYGVADLEAVVRAGVDVVRLPKTDSA
FT                   DDVIAIENEIARIERACGRDVGSTGLLAAIESAQGITQAVAIAHASPRLIGIALGAEDY
FT                   VRNLRTERSPEGIELLFARCSILQAARSAGIQAFDTVYSDANNDEGFLREASHIKQLGF
FT                   DGKSLINPRQIELLHNLYAPTQKEVDHARLVVDAAEASAREGRGVVSLNGKMVDSPVIE
FT                   RARLVLSRAALSGIREE"
     MTPQQKTRTR RSMLFVPGAN AAMLSNAFIY KADALMFDLE DSVVLREKDA ARRLVYHALQ        60
     HPLYHDIETI VRVNALDSAY GVADLEAVVR AGVDVVRLPK TDSADDVIAI ENEIARIERA       120
     CGRDVGSTGL LAAIESAQGI TQAVAIAHAS PRLIGIALGA EDYVRNLRTE RSPEGIELLF       180
     ARCSILQAAR SAGIQAFDTV YSDANNDEGF LREASHIKQL GFDGKSLINP RQIELLHNLY       240
     APTQKEVDHA RLVVDAAEAS AREGRGVVSL NGKMVDSPVI ERARLVLSRA ALSGIREE         298
//

If you have problems or comments...

PBIL Back to PBIL home page