(data stored in ACNUC7421 zone)

EMBL: CP001600.PE207

CP001600.PE207       Location/Qualifiers
FT   CDS             complement(239403..239702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0233"
FT                   /product="citrate lyase acyl carrier protein, putative"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67476"
FT                   /db_xref="GOA:C5B714"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B714"
FT                   /protein_id="ACR67476.1"
FT                   /translation="MKINHAAVAGTLESSDVMVRIAPIEDDQALDLQISSSVEKQFGDA
FT                   IRATVLDVLNRYQVRGIQLIVDDKGALDCVLRARLETLLARAADLVSLPWEDRA"
     MKINHAAVAG TLESSDVMVR IAPIEDDQAL DLQISSSVEK QFGDAIRATV LDVLNRYQVR        60
     GIQLIVDDKG ALDCVLRARL ETLLARAADL VSLPWEDRA                               99
//

If you have problems or comments...

PBIL Back to PBIL home page