(data stored in ACNUC7421 zone)

EMBL: CP001600.PE209

CP001600.PE209       Location/Qualifiers
FT   CDS             241163..242806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0235"
FT                   /product="sensor kinase DpiB, putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67478"
FT                   /db_xref="GOA:C5B716"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C5B716"
FT                   /protein_id="ACR67478.1"
FT                   /translation="MVRMPNNSAVNFFRRMAFPLRIFLLLLLVSCCLFAALGKYLSASF
FT                   EDYMMRQVHDMAMNQAKIIASMDSVVEGVKARDTHRLALIADRLGTGTDFDYVVIGDRN
FT                   SVRLYHPNPAKIGHKMQFTKPGAMEKGESYFISGKGSLGQALRAKTPIFDHQGQVIGVV
FT                   SLGYLVSKIDSWRLDFLLPMAGVFVCVLLLLLLLSWLFAAHIRRQMMGMEPRQIARVVR
FT                   QMEALFGAVFEGLIAVDPDGQITAINRNARKMLGLSAPGRQWLGQPISQVVSPSDFFTD
FT                   RINEDRRDAILTFNGLNVIANRATIRSGDGDTLLGAIISFRSKDDINTLNAQLTQIRQY
FT                   VDSLRTVRHEHLNWMSTLSGLLQMKEYDRALEMVRGASQAQQQLIDRLRDAFSDKVVAG
FT                   LLFGKVHRARELGLTLTIVDGSQLHALPAGLDNTEFAAVLGNLLDNAFDASLKNPQGGG
FT                   GVEVYLSDEGREVIIEVADQGCGVPDTLKDNIFEQGVSTKAEDPGEHGIGLYLIARYVG
FT                   RCGGTITLEDNQPYGTLFSVFIPKVKREHE"
     MVRMPNNSAV NFFRRMAFPL RIFLLLLLVS CCLFAALGKY LSASFEDYMM RQVHDMAMNQ        60
     AKIIASMDSV VEGVKARDTH RLALIADRLG TGTDFDYVVI GDRNSVRLYH PNPAKIGHKM       120
     QFTKPGAMEK GESYFISGKG SLGQALRAKT PIFDHQGQVI GVVSLGYLVS KIDSWRLDFL       180
     LPMAGVFVCV LLLLLLLSWL FAAHIRRQMM GMEPRQIARV VRQMEALFGA VFEGLIAVDP       240
     DGQITAINRN ARKMLGLSAP GRQWLGQPIS QVVSPSDFFT DRINEDRRDA ILTFNGLNVI       300
     ANRATIRSGD GDTLLGAIIS FRSKDDINTL NAQLTQIRQY VDSLRTVRHE HLNWMSTLSG       360
     LLQMKEYDRA LEMVRGASQA QQQLIDRLRD AFSDKVVAGL LFGKVHRARE LGLTLTIVDG       420
     SQLHALPAGL DNTEFAAVLG NLLDNAFDAS LKNPQGGGGV EVYLSDEGRE VIIEVADQGC       480
     GVPDTLKDNI FEQGVSTKAE DPGEHGIGLY LIARYVGRCG GTITLEDNQP YGTLFSVFIP       540
     KVKREHE                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page