(data stored in ACNUC7421 zone)

EMBL: CP001600.PE21

CP001600.PE21        Location/Qualifiers
FT   CDS             18770..19429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0023"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67283"
FT                   /db_xref="GOA:C5B9A3"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A3"
FT                   /protein_id="ACR67283.1"
FT                   /translation="MFSFTPQQRFTALCWLSLFHILIITSSNYLVQLPITVFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILAVMVPALLISYCVSALFFQGQWQGFAALGSV
FT                   NLMVARIACASFMAYVLGQILDVHVFNRLRQTQAWWVAPTASTLFGNISDTLSFFFIAF
FT                   YRSSDAFMATHWIEIALVDYAFKLLISMVFFLPMYGVMLNMLLKRIAFRQQQVSPA"
     MFSFTPQQRF TALCWLSLFH ILIITSSNYL VQLPITVFGF HTTWGAFTFP FIFLATDLTV        60
     RIFGAPLARR IILAVMVPAL LISYCVSALF FQGQWQGFAA LGSVNLMVAR IACASFMAYV       120
     LGQILDVHVF NRLRQTQAWW VAPTASTLFG NISDTLSFFF IAFYRSSDAF MATHWIEIAL       180
     VDYAFKLLIS MVFFLPMYGV MLNMLLKRIA FRQQQVSPA                              219
//

If you have problems or comments...

PBIL Back to PBIL home page