(data stored in ACNUC7421 zone)

EMBL: CP001600.PE210

CP001600.PE210       Location/Qualifiers
FT   CDS             242799..243485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0236"
FT                   /product="transcriptional regulatory protein DpiA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67479"
FT                   /db_xref="GOA:C5B717"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:C5B717"
FT                   /protein_id="ACR67479.1"
FT                   /translation="MNKINILIVEDETPLAEMHAEFIRNHPCCGQLWLAGNLAQARAMI
FT                   KHFHPDLVLLDNYLPDGVGVHLLHELTQQRYPGGVVLTTAASDMDTVSEAVRSGAFDYL
FT                   IKPIAYERLGQTLDRYQQRNSMLSGHQNASQRQIDSMYNAYARGDSKEDLPVGIDALTL
FT                   EKVQGLFVDDTVRHTAESVAQSLMLSRTTARRYLEFCAARQQIVAEIVYGKVGRPQRIY
FT                   RAQGKI"
     MNKINILIVE DETPLAEMHA EFIRNHPCCG QLWLAGNLAQ ARAMIKHFHP DLVLLDNYLP        60
     DGVGVHLLHE LTQQRYPGGV VLTTAASDMD TVSEAVRSGA FDYLIKPIAY ERLGQTLDRY       120
     QQRNSMLSGH QNASQRQIDS MYNAYARGDS KEDLPVGIDA LTLEKVQGLF VDDTVRHTAE       180
     SVAQSLMLSR TTARRYLEFC AARQQIVAEI VYGKVGRPQR IYRAQGKI                    228
//

If you have problems or comments...

PBIL Back to PBIL home page