(data stored in ACNUC7421 zone)

EMBL: CP001600.PE212

CP001600.PE212       Location/Qualifiers
FT   CDS             244368..245699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0238"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67481"
FT                   /db_xref="GOA:C5B719"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5B719"
FT                   /protein_id="ACR67481.1"
FT                   /translation="MRGVFREDKALWRLALPMILSNVSVPLLGVVDTAVIGHLDSPVYL
FT                   GGVAVGSMATTFLFMLLLFLRMSTTGLCAQAFGAADRPALARALLQPLIMALLAGVGII
FT                   LLRQPLSALMLQIVGAGAAIQAQAQLFMHIRWLSAPATLANLVILGWLLGVQYARAPVL
FT                   LLIVGNVVNIALDLWLVVGLGWKVAGAAWATVIADYVTLLMGAALLLHVMRLRGLRRAH
FT                   FRHAWRGNLRRLMALNRDIMLRSLLLQLCFASLTVIGARLGADIVAVNAVLMNLLTFTA
FT                   YALDGFAYAVEAYSGQAFGARDAPVLRRVWRAACRQAGAVALLFALAYSLFGRDIVNLL
FT                   TSLPQVQTLALDYLPWQVVLPLLGVWCYLLDGMFIGATRGADMRNSMAVAALGYGMTLL
FT                   SIPWLGNHGLWLALAVFLMLRGLSLWLIWRRRWRTQRWFPTGAA"
     MRGVFREDKA LWRLALPMIL SNVSVPLLGV VDTAVIGHLD SPVYLGGVAV GSMATTFLFM        60
     LLLFLRMSTT GLCAQAFGAA DRPALARALL QPLIMALLAG VGIILLRQPL SALMLQIVGA       120
     GAAIQAQAQL FMHIRWLSAP ATLANLVILG WLLGVQYARA PVLLLIVGNV VNIALDLWLV       180
     VGLGWKVAGA AWATVIADYV TLLMGAALLL HVMRLRGLRR AHFRHAWRGN LRRLMALNRD       240
     IMLRSLLLQL CFASLTVIGA RLGADIVAVN AVLMNLLTFT AYALDGFAYA VEAYSGQAFG       300
     ARDAPVLRRV WRAACRQAGA VALLFALAYS LFGRDIVNLL TSLPQVQTLA LDYLPWQVVL       360
     PLLGVWCYLL DGMFIGATRG ADMRNSMAVA ALGYGMTLLS IPWLGNHGLW LALAVFLMLR       420
     GLSLWLIWRR RWRTQRWFPT GAA                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page