(data stored in ACNUC7421 zone)

EMBL: CP001600.PE214

CP001600.PE214       Location/Qualifiers
FT   CDS             246630..247280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67483"
FT                   /db_xref="UniProtKB/TrEMBL:C5B721"
FT                   /protein_id="ACR67483.1"
FT                   /translation="MDLILAIEHWPLRQAIVELYRRQFTIISLPDAVPFSPRILSALHR
FT                   AGSLLVTDRQRHNLLQTVERVRRHSLIPVIIINRQDNYLTQLIARFFNGAHALSYDSFY
FT                   RHIQRRTFHPLDLYFLPYSRGAQDACWSTGETVYARLNAFGLMTLYQRGVTLREAAVLL
FT                   SLSYHNSTAMTARLLGIHEQAVVYCKRTLGSKLGLDHHRPDFISHIFLSPDAR"
     MDLILAIEHW PLRQAIVELY RRQFTIISLP DAVPFSPRIL SALHRAGSLL VTDRQRHNLL        60
     QTVERVRRHS LIPVIIINRQ DNYLTQLIAR FFNGAHALSY DSFYRHIQRR TFHPLDLYFL       120
     PYSRGAQDAC WSTGETVYAR LNAFGLMTLY QRGVTLREAA VLLSLSYHNS TAMTARLLGI       180
     HEQAVVYCKR TLGSKLGLDH HRPDFISHIF LSPDAR                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page