(data stored in ACNUC7421 zone)

EMBL: CP001600.PE22

CP001600.PE22        Location/Qualifiers
FT   CDS             19839..20009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67284"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A4"
FT                   /protein_id="ACR67284.1"
FT                   /translation="MFRDCFNPQGRIPFVLPNRAQAAVYPVSGALGIFPDSAFSGFYAM
FT                   LSFYLPTEGTR"
     MFRDCFNPQG RIPFVLPNRA QAAVYPVSGA LGIFPDSAFS GFYAMLSFYL PTEGTR            56
//

If you have problems or comments...

PBIL Back to PBIL home page