(data stored in ACNUC7421 zone)

EMBL: CP001600.PE223

CP001600.PE223       Location/Qualifiers
FT   CDS             complement(255423..256055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0249"
FT                   /product="Opacity family porin protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67492"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC9"
FT                   /protein_id="ACR67492.1"
FT                   /translation="MKAFTKLALFVGLVSGATLANAAGTNNTGYYAGAKMGISAEHLFD
FT                   QKDVNGNGMSNDNKGVGNAGLVFGYNFENQFSLPVRAELDYTFRAHATSSHTNDAAETN
FT                   NSRLGLQTLMVNGYYDIKTGTPFTPYIGAGIGYANVSLKNDMNGDNVQSNSNNFAWSVG
FT                   TGVIYNVNERLDLDLGYKYLDAGKANAGNSQAKVATHDFTLGVNYYF"
     MKAFTKLALF VGLVSGATLA NAAGTNNTGY YAGAKMGISA EHLFDQKDVN GNGMSNDNKG        60
     VGNAGLVFGY NFENQFSLPV RAELDYTFRA HATSSHTNDA AETNNSRLGL QTLMVNGYYD       120
     IKTGTPFTPY IGAGIGYANV SLKNDMNGDN VQSNSNNFAW SVGTGVIYNV NERLDLDLGY       180
     KYLDAGKANA GNSQAKVATH DFTLGVNYYF                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page