(data stored in ACNUC7421 zone)

EMBL: CP001600.PE224

CP001600.PE224       Location/Qualifiers
FT   CDS             256800..257654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0250"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67493"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD0"
FT                   /protein_id="ACR67493.1"
FT                   /translation="MIHLFNSMNIYPGIPIPDIPAENSSPEPDAVAAVLDSRHNYERIL
FT                   CHGPLSGVKSIEAGGNTTLLKFIERLMQERQFIDTLNEKNNQSYNSMYALEQIISEIGV
FT                   NSEEEIKISSALKQAVSDINHSIADVNRLSNQTNLPAMETAHVSAQGCGFSFIVKVIKS
FT                   RASEVKQHAAQIALLSNTISARAGQVCESVSAIHALITRISQEMASTSETLEQVIERSG
FT                   HMQKIIHHIAIQQFLNMVKRVHIIWKYQVCHYLFIRDRQAVMNVHHSCRLGHRYYTGEG
FT                   VMI"
     MIHLFNSMNI YPGIPIPDIP AENSSPEPDA VAAVLDSRHN YERILCHGPL SGVKSIEAGG        60
     NTTLLKFIER LMQERQFIDT LNEKNNQSYN SMYALEQIIS EIGVNSEEEI KISSALKQAV       120
     SDINHSIADV NRLSNQTNLP AMETAHVSAQ GCGFSFIVKV IKSRASEVKQ HAAQIALLSN       180
     TISARAGQVC ESVSAIHALI TRISQEMAST SETLEQVIER SGHMQKIIHH IAIQQFLNMV       240
     KRVHIIWKYQ VCHYLFIRDR QAVMNVHHSC RLGHRYYTGE GVMI                        284
//

If you have problems or comments...

PBIL Back to PBIL home page