(data stored in ACNUC7421 zone)

EMBL: CP001600.PE227

CP001600.PE227       Location/Qualifiers
FT   CDS             complement(258541..259221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0253"
FT                   /product="respiratory nitrate reductase, gamma subunit,
FT                   putative"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67496"
FT                   /db_xref="GOA:C5BCD3"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD3"
FT                   /protein_id="ACR67496.1"
FT                   /translation="MSALSYFLFNIYPYIAITVLLLGCLYRFDYGQYTWKSGSSLLMAN
FT                   GRYSRYALNLFHVGMLGVFFGHVAGLLTPRSWYDAYISSQTHQILELIAGSLFGTLLLI
FT                   GALMLLARRLFCARVAATSSFSDKMILILLTIQICLGMLTIPVDLLHPSGATLQNLISW
FT                   SQGIVTFRPDPAQYLQEVNWLFKVHMVLGLTIFLIFPFTRLVHICSLPLGYLLRRRQVV
FT                   KTLR"
     MSALSYFLFN IYPYIAITVL LLGCLYRFDY GQYTWKSGSS LLMANGRYSR YALNLFHVGM        60
     LGVFFGHVAG LLTPRSWYDA YISSQTHQIL ELIAGSLFGT LLLIGALMLL ARRLFCARVA       120
     ATSSFSDKMI LILLTIQICL GMLTIPVDLL HPSGATLQNL ISWSQGIVTF RPDPAQYLQE       180
     VNWLFKVHMV LGLTIFLIFP FTRLVHICSL PLGYLLRRRQ VVKTLR                      226
//

If you have problems or comments...

PBIL Back to PBIL home page