(data stored in ACNUC7421 zone)

EMBL: CP001600.PE229

CP001600.PE229       Location/Qualifiers
FT   CDS             complement(259889..261409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0255"
FT                   /product="nitrate reductase, beta subunit, putative"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67498"
FT                   /db_xref="GOA:C5BCD5"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD5"
FT                   /protein_id="ACR67498.1"
FT                   /translation="MKIRAQVSMVLNLDKCIGCHTCSVVCKNVWTSREGIEYGWFNNVE
FT                   TKPGRGFPRDWEDQDKWHGGWQRVNGQLTPRMGGKLSLLAKIFANPHMPAIGDYYEPYS
FT                   FDYAHLHNAPAGARHQPTARPYSLLTGKTLEKIEGSANWEDDLGGEARVRQGDRNLDGL
FT                   DKQRYAQFEQTFMMYLPRLCEHCLNPACVASCPSGAIYKRAEDGVVLINQDQCRGWRMC
FT                   VSACPYKKIYYNWKSGKSEKCIFCYPRIEAGLPTLCSESCVGRIRYIGVMLYDAEAIPT
FT                   AAAEADPQALYEAQMKIFLDPGDPDVIAQARRDGISDEILEHAQRSPVYRLIKEWRLAL
FT                   PLHPEFRTLPMVWYVPPLSPIRFDDAGLAEPHDIHLAELAQMRIPIDYLANLLCAGNRK
FT                   PVEAALTRLSALRHYRRSLLSPQAPQWLQQANLSAPQAEAMYHLLALAPYHERFVIPTG
FT                   MHRPGGDREYIEHGSCGFSFNSPHDTDGANLTGYRPDDRLVISTHSKE"
     MKIRAQVSMV LNLDKCIGCH TCSVVCKNVW TSREGIEYGW FNNVETKPGR GFPRDWEDQD        60
     KWHGGWQRVN GQLTPRMGGK LSLLAKIFAN PHMPAIGDYY EPYSFDYAHL HNAPAGARHQ       120
     PTARPYSLLT GKTLEKIEGS ANWEDDLGGE ARVRQGDRNL DGLDKQRYAQ FEQTFMMYLP       180
     RLCEHCLNPA CVASCPSGAI YKRAEDGVVL INQDQCRGWR MCVSACPYKK IYYNWKSGKS       240
     EKCIFCYPRI EAGLPTLCSE SCVGRIRYIG VMLYDAEAIP TAAAEADPQA LYEAQMKIFL       300
     DPGDPDVIAQ ARRDGISDEI LEHAQRSPVY RLIKEWRLAL PLHPEFRTLP MVWYVPPLSP       360
     IRFDDAGLAE PHDIHLAELA QMRIPIDYLA NLLCAGNRKP VEAALTRLSA LRHYRRSLLS       420
     PQAPQWLQQA NLSAPQAEAM YHLLALAPYH ERFVIPTGMH RPGGDREYIE HGSCGFSFNS       480
     PHDTDGANLT GYRPDDRLVI STHSKE                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page