(data stored in ACNUC7421 zone)

EMBL: CP001600.PE230

CP001600.PE230       Location/Qualifiers
FT   CDS             complement(261436..265107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0256"
FT                   /product="nitrate reductase, alpha subunit, putative"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67499"
FT                   /db_xref="GOA:C5BCD6"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD6"
FT                   /protein_id="ACR67499.1"
FT                   /translation="MSTFLKKIRYFTAGKPMAANAHELYLQDSVGWEQSYRSRWQYDKV
FT                   VRSTHGVNCTGSCSWKIYVKSGLITWETQYTDYPETPIDLPNHEPRGCPRGASYSWYIY
FT                   SANRIKYPLMRSALRDLWREQKALHPDAVDAWLAILDNPELSQCYKRERGMGGLVRVSW
FT                   QEANELIAASNIATVKRFGPDRVAGFSPIPAHAMLSFASGSRYLSLIGGTCLSFYDWYC
FT                   DLPPSSPQTWGEQTDVPESADWYNAQYLVMWGSNVPQTRTPDAHFMTEARYNGTKVVAI
FT                   SADYAENCKFADEWLAPRAGTDSALALALGQVILQQFYLRQPCDYFVRYAKRFTDFPML
FT                   VMLSPCSGQENTYQSGRYLRAADLAAWREQPLAQWKTLAFDQGSRQIVIPRGSAGFRWD
FT                   QGGQWNTVQQDALSGAAIDPLLSLQALDEGEVCVVQPDFSHDNANDRYTYGQVPVHWIT
FT                   TASGECVAVATVFDLMLAHYGLRPRTGEIPAEDAPCSPAWAEAITGVPRQQIIRLAQEF
FT                   ANNARLTHGRSLIIVGAGINHWFHSDMTYRSIINVLMMCGTIGVNGGGWAHYVGQEKLR
FT                   PLAGWAPVALAGDWQSPARLMNGTSFFYNHTSQWRYENVDAHTLLSPLAERDRFPHSLI
FT                   DFNVIAERLGWLPSSPQLDRNPLTLAAGAAEGDVRAGVAQALKQGSLRIASEDPDAPGN
FT                   YPRILFVWRANLLGSSSKGHEYFLKHLLGTRHGVMEQDLQQKGLPLPQQVTWRDSVEGK
FT                   LDLLVTLDFRMSTTCLYSDVILPSATWYEKEDLSSTDMHPYIHPFTRAIDPMWEARPDW
FT                   DIFKGIARQFSALCEGHLGKERDVVLTPLLHDSPAELGQACGVSDWKNDPQTFVAGKTA
FT                   PAIAVVARDYPQTYFKYTHLGPALAAHGNGGKGVHWDTRPEIDSLYARHGSETLDGVGP
FT                   CANMQDATQALETILTLAPETNGQVADRAWRDLAAKTGQQEIAGLAADKKGVHYRFADI
FT                   QRQPGRVIASPLWSGIDSDRHAYTAGSLNITHAVPWRTLTGRQQAYQDHAWMQAFGEGF
FT                   ACYKPPLDTQSCRSVREHTANGQPELVLNFGTAHQKWGIHSTYTDNQIMQTLSRGGPLI
FT                   WISEHDAQRGAIADNDWVELFNGNGAMVARAVVSQRIPAGLALMYHAQERTLNMPLSEV
FT                   TGKRGGIHNSITRICPNPIHMIGGYAHLSWGYNYYGTIGSNRDETVIIRRLNRVEWD"
     MSTFLKKIRY FTAGKPMAAN AHELYLQDSV GWEQSYRSRW QYDKVVRSTH GVNCTGSCSW        60
     KIYVKSGLIT WETQYTDYPE TPIDLPNHEP RGCPRGASYS WYIYSANRIK YPLMRSALRD       120
     LWREQKALHP DAVDAWLAIL DNPELSQCYK RERGMGGLVR VSWQEANELI AASNIATVKR       180
     FGPDRVAGFS PIPAHAMLSF ASGSRYLSLI GGTCLSFYDW YCDLPPSSPQ TWGEQTDVPE       240
     SADWYNAQYL VMWGSNVPQT RTPDAHFMTE ARYNGTKVVA ISADYAENCK FADEWLAPRA       300
     GTDSALALAL GQVILQQFYL RQPCDYFVRY AKRFTDFPML VMLSPCSGQE NTYQSGRYLR       360
     AADLAAWREQ PLAQWKTLAF DQGSRQIVIP RGSAGFRWDQ GGQWNTVQQD ALSGAAIDPL       420
     LSLQALDEGE VCVVQPDFSH DNANDRYTYG QVPVHWITTA SGECVAVATV FDLMLAHYGL       480
     RPRTGEIPAE DAPCSPAWAE AITGVPRQQI IRLAQEFANN ARLTHGRSLI IVGAGINHWF       540
     HSDMTYRSII NVLMMCGTIG VNGGGWAHYV GQEKLRPLAG WAPVALAGDW QSPARLMNGT       600
     SFFYNHTSQW RYENVDAHTL LSPLAERDRF PHSLIDFNVI AERLGWLPSS PQLDRNPLTL       660
     AAGAAEGDVR AGVAQALKQG SLRIASEDPD APGNYPRILF VWRANLLGSS SKGHEYFLKH       720
     LLGTRHGVME QDLQQKGLPL PQQVTWRDSV EGKLDLLVTL DFRMSTTCLY SDVILPSATW       780
     YEKEDLSSTD MHPYIHPFTR AIDPMWEARP DWDIFKGIAR QFSALCEGHL GKERDVVLTP       840
     LLHDSPAELG QACGVSDWKN DPQTFVAGKT APAIAVVARD YPQTYFKYTH LGPALAAHGN       900
     GGKGVHWDTR PEIDSLYARH GSETLDGVGP CANMQDATQA LETILTLAPE TNGQVADRAW       960
     RDLAAKTGQQ EIAGLAADKK GVHYRFADIQ RQPGRVIASP LWSGIDSDRH AYTAGSLNIT      1020
     HAVPWRTLTG RQQAYQDHAW MQAFGEGFAC YKPPLDTQSC RSVREHTANG QPELVLNFGT      1080
     AHQKWGIHST YTDNQIMQTL SRGGPLIWIS EHDAQRGAIA DNDWVELFNG NGAMVARAVV      1140
     SQRIPAGLAL MYHAQERTLN MPLSEVTGKR GGIHNSITRI CPNPIHMIGG YAHLSWGYNY      1200
     YGTIGSNRDE TVIIRRLNRV EWD                                              1223
//

If you have problems or comments...

PBIL Back to PBIL home page