(data stored in ACNUC7421 zone)

EMBL: CP001600.PE235

CP001600.PE235       Location/Qualifiers
FT   CDS             complement(269590..269742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67504"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE1"
FT                   /protein_id="ACR67504.1"
FT                   /translation="MSPSARYREKLGILFLITSKYFIKADSDIVIANYIIYISTTVHAI
FT                   TQERL"
     MSPSARYREK LGILFLITSK YFIKADSDIV IANYIIYIST TVHAITQERL                   50
//

If you have problems or comments...

PBIL Back to PBIL home page