(data stored in ACNUC7421 zone)

EMBL: CP001600.PE236

CP001600.PE236       Location/Qualifiers
FT   CDS             complement(270156..270293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0262"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67505"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE2"
FT                   /protein_id="ACR67505.1"
FT                   /translation="MRQHLRSTDVAGMLDSIAHRRPLPQVLKADNGSEFAGEILDRGGE
FT                   "
     MRQHLRSTDV AGMLDSIAHR RPLPQVLKAD NGSEFAGEIL DRGGE                        45
//

If you have problems or comments...

PBIL Back to PBIL home page