(data stored in ACNUC7421 zone)

EMBL: CP001600.PE237

CP001600.PE237       Location/Qualifiers
FT   CDS             complement(270306..270542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67506"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE3"
FT                   /protein_id="ACR67506.1"
FT                   /translation="MLQREGWHDNRTWIYRLYCEQGLSLRLNGHATINQPSGGSCSLMA
FT                   CLQTRFGAWILSLIRGLTVTAAPIDDFDLYTRE"
     MLQREGWHDN RTWIYRLYCE QGLSLRLNGH ATINQPSGGS CSLMACLQTR FGAWILSLIR        60
     GLTVTAAPID DFDLYTRE                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page