(data stored in ACNUC7421 zone)

EMBL: CP001600.PE239

CP001600.PE239       Location/Qualifiers
FT   CDS             complement(270978..272165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0265"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67508"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE5"
FT                   /protein_id="ACR67508.1"
FT                   /translation="MIKIKIRVSKEIIITALLLFLSGCATTSPPKTAVKKIAPPPVTHE
FT                   RKGYSVQKGTIFLISSSSQYDENVIPEIEMAFSRQCYSVDKRYLNQQPTRLGYVNTDEK
FT                   RAQTLINALSDRNVRYLWFIRGGSGAFNLYPALHAERQHISKSTPKIIIGFSDVTAIHS
FT                   FVNHELNWSSVHGVLASSNKEMHDIDKSKKASMNNSLSEVFETLSHGSHYTGIEPMNSQ
FT                   AVKKVSGKLDGGNMTLVQSLFSTIYEGSYSDKIMMLEDIGVTEKQLDRTLHQIAFSRKF
FT                   HPRAVIFGQFYGQDASDEEKSLYRYVIQQFANLVSYPVYYYPEFGHAETNQPFILNHQV
FT                   NILCSSKYRLCSLTQAPALFMSDPAPKSCAIQKQNSGMRNTPLGGGGTDEKVTIH"
     MIKIKIRVSK EIIITALLLF LSGCATTSPP KTAVKKIAPP PVTHERKGYS VQKGTIFLIS        60
     SSSQYDENVI PEIEMAFSRQ CYSVDKRYLN QQPTRLGYVN TDEKRAQTLI NALSDRNVRY       120
     LWFIRGGSGA FNLYPALHAE RQHISKSTPK IIIGFSDVTA IHSFVNHELN WSSVHGVLAS       180
     SNKEMHDIDK SKKASMNNSL SEVFETLSHG SHYTGIEPMN SQAVKKVSGK LDGGNMTLVQ       240
     SLFSTIYEGS YSDKIMMLED IGVTEKQLDR TLHQIAFSRK FHPRAVIFGQ FYGQDASDEE       300
     KSLYRYVIQQ FANLVSYPVY YYPEFGHAET NQPFILNHQV NILCSSKYRL CSLTQAPALF       360
     MSDPAPKSCA IQKQNSGMRN TPLGGGGTDE KVTIH                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page