(data stored in ACNUC7421 zone)

EMBL: CP001600.PE24

CP001600.PE24        Location/Qualifiers
FT   CDS             20521..21096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0026"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67286"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A6"
FT                   /protein_id="ACR67286.1"
FT                   /translation="MGNLVKLIGVGLLVTGLAACDGSSTAETNAPVQGANATQPSVPEG
FT                   AKVSLLDGKIGFTLPAGLSDQTSKLGSQTNNMSVYANKTGQQAVIVILAPMPQDNLNAL
FT                   STRLIDQQKSRDASLQLLSSESVKLGGKEVEKVVSMQQANGHAIYSSIILAQVGDQLMT
FT                   MQISLPGDNRQEAANIANGVLDTLSFAR"
     MGNLVKLIGV GLLVTGLAAC DGSSTAETNA PVQGANATQP SVPEGAKVSL LDGKIGFTLP        60
     AGLSDQTSKL GSQTNNMSVY ANKTGQQAVI VILAPMPQDN LNALSTRLID QQKSRDASLQ       120
     LLSSESVKLG GKEVEKVVSM QQANGHAIYS SIILAQVGDQ LMTMQISLPG DNRQEAANIA       180
     NGVLDTLSFA R                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page