(data stored in ACNUC7421 zone)

EMBL: CP001600.PE241

CP001600.PE241       Location/Qualifiers
FT   CDS             complement(272963..274663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67510"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE7"
FT                   /protein_id="ACR67510.1"
FT                   /translation="MRDTSVNTYARAFSPDKNIKKPVVDEKSSMPTQIAKVVLGILNPG
FT                   IDHEAICLIDKHINRDPKTIGFMDNVRTIHDALSDAVVSDIKEVDVSFSDEFEALTFKE
FT                   KKDDTGNPIVTITYGNHDDNIKGTLASIVRKLEDDFNASPDLYKIGSSYRSLDARLELT
FT                   EIKDMKSEMAMIPAPEIYADDPKNLKAYKISPSTALLMAIKDFPQKNSEISSFLFTGRT
FT                   SENYVSFDKLIVEFCKLHPEYHVATGSTFINRDPVRNYFETQFSFNYLINNLHAIDEGE
FT                   LDALICENMKLLNEDDDILSRTLSGNAIDRDDLIHKEYSDAIANIKVGVGYGGIPLEER
FT                   GKLEKIVKLSFLSVAVAWIKCLPIDIYNTGVYDDDIKGKTIKSNQSHVTSAHMGMMKSY
FT                   HPLPRDDIAYRDKATTFIRPVDQASFSEYAPLVVNVNSKLVHARSNGISGTMLCQARVL
FT                   QYLKEIEAFCFNKTNPLVYIHVLASAMLFNSGGHSYNEFLSPFTLKRVNTRLSSVFDVV
FT                   GEGYRMDSIVSNVGINPSVVDKTLSYFNHLEMKQKLHNELMAKRARVYG"
     MRDTSVNTYA RAFSPDKNIK KPVVDEKSSM PTQIAKVVLG ILNPGIDHEA ICLIDKHINR        60
     DPKTIGFMDN VRTIHDALSD AVVSDIKEVD VSFSDEFEAL TFKEKKDDTG NPIVTITYGN       120
     HDDNIKGTLA SIVRKLEDDF NASPDLYKIG SSYRSLDARL ELTEIKDMKS EMAMIPAPEI       180
     YADDPKNLKA YKISPSTALL MAIKDFPQKN SEISSFLFTG RTSENYVSFD KLIVEFCKLH       240
     PEYHVATGST FINRDPVRNY FETQFSFNYL INNLHAIDEG ELDALICENM KLLNEDDDIL       300
     SRTLSGNAID RDDLIHKEYS DAIANIKVGV GYGGIPLEER GKLEKIVKLS FLSVAVAWIK       360
     CLPIDIYNTG VYDDDIKGKT IKSNQSHVTS AHMGMMKSYH PLPRDDIAYR DKATTFIRPV       420
     DQASFSEYAP LVVNVNSKLV HARSNGISGT MLCQARVLQY LKEIEAFCFN KTNPLVYIHV       480
     LASAMLFNSG GHSYNEFLSP FTLKRVNTRL SSVFDVVGEG YRMDSIVSNV GINPSVVDKT       540
     LSYFNHLEMK QKLHNELMAK RARVYG                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page