(data stored in ACNUC7421 zone)

EMBL: CP001600.PE243

CP001600.PE243       Location/Qualifiers
FT   CDS             complement(276239..277318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0270"
FT                   /product="transglycosylase SLT domain protein"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67512"
FT                   /db_xref="GOA:C5BCE9"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023664"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCE9"
FT                   /protein_id="ACR67512.1"
FT                   /translation="MKKVLALALIAPLLISCSGKKPDSNGEEYIKDTNGFDILMGQFAH
FT                   NIENIWGINEVLIAGPKDYVKYSDRYLTRSHINFETGQITIETIATLNPAETLRQAIVT
FT                   TLLMGDDPSSIDLYSDANDIKPSREPFLYGQVLDNTGQPIRWSGRANSFADYLLQNKLM
FT                   KRTSGLHVIYSVTIQLVPNHLDKRAHKYLDMVRRASERYGVDESLILAIMQTESSFNPY
FT                   AVSRSDALGLMQVMQHTAGKDVFVSKGKWGTPSRSYLFDPEKNIDTGTAYLAILQNTYL
FT                   GGIQNTTSRRYAVITAYNGGAGSVLRIFSSDKGQAVNIINQMSPGDVYEALTQRHPSAE
FT                   SRRYLYKVNNTQKNYRRIR"
     MKKVLALALI APLLISCSGK KPDSNGEEYI KDTNGFDILM GQFAHNIENI WGINEVLIAG        60
     PKDYVKYSDR YLTRSHINFE TGQITIETIA TLNPAETLRQ AIVTTLLMGD DPSSIDLYSD       120
     ANDIKPSREP FLYGQVLDNT GQPIRWSGRA NSFADYLLQN KLMKRTSGLH VIYSVTIQLV       180
     PNHLDKRAHK YLDMVRRASE RYGVDESLIL AIMQTESSFN PYAVSRSDAL GLMQVMQHTA       240
     GKDVFVSKGK WGTPSRSYLF DPEKNIDTGT AYLAILQNTY LGGIQNTTSR RYAVITAYNG       300
     GAGSVLRIFS SDKGQAVNII NQMSPGDVYE ALTQRHPSAE SRRYLYKVNN TQKNYRRIR        359
//

If you have problems or comments...

PBIL Back to PBIL home page