(data stored in ACNUC7421 zone)

EMBL: CP001600.PE249

CP001600.PE249       Location/Qualifiers
FT   CDS             281197..281925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0276"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67518"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR2"
FT                   /protein_id="ACR67518.1"
FT                   /translation="MGKWGCSLLLLLATAQVQAAWQCQVKPQDDIIISAQQVQIVGASG
FT                   NLQISRDGAVTRDGHPLALSADARRQAETLQRDLRRDVPWIDQGVQTRLDRARGALDNI
FT                   IVEQLGSDSNVRNRLSTLDTQLKAQMNRVLEKRSDGYAFHHQAIAQVEKEGQTLVNQTL
FT                   GGVLQDSINEMGAKGLLKAGQSENPLQAVLGNLGGLQQSIRSEWDKQDNDLRAFGQQAC
FT                   ERVQALDSQRKALLKALPAS"
     MGKWGCSLLL LLATAQVQAA WQCQVKPQDD IIISAQQVQI VGASGNLQIS RDGAVTRDGH        60
     PLALSADARR QAETLQRDLR RDVPWIDQGV QTRLDRARGA LDNIIVEQLG SDSNVRNRLS       120
     TLDTQLKAQM NRVLEKRSDG YAFHHQAIAQ VEKEGQTLVN QTLGGVLQDS INEMGAKGLL       180
     KAGQSENPLQ AVLGNLGGLQ QSIRSEWDKQ DNDLRAFGQQ ACERVQALDS QRKALLKALP       240
     AS                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page