(data stored in ACNUC7421 zone)

EMBL: CP001600.PE25

CP001600.PE25        Location/Qualifiers
FT   CDS             complement(21121..22815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0027"
FT                   /product="AsmA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67287"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A7"
FT                   /protein_id="ACR67287.1"
FT                   /translation="MKVIGKLLLTLCVLLLLALAAVYFIGQSRWGARQISDWVNQHTNY
FT                   RITLSALQHTLRQPTVVQVNGFSLARAGQPPLLQSATLRLTFGWQQLSAPRHFSAIGLS
FT                   GGKLTLTQDGIPPLPISAAALRLHDMQILWPHADWPLQASDVDGGIVPLRPGSAKADFQ
FT                   FSATALSIGDIPAKNVLVQGEYRDRQLWLNNLGADVANGQMTAQALRQTDGTWRIDNLR
FT                   LSQIHWQSSQALQPFLHALQILPPLTLVRLDLLGANLEGKGWALGGLDATLRNVSLANG
FT                   HWRSQKGSLTLNATDIVLGAMHLSDPLLSADLTPQGVTLRQFNTRWSNALIRTHGDWQR
FT                   DNGHLTLNDLAVIGLEYTLPNAWRTLWLHPLPTWLQEITLQRFSLSRTLLVDINPDFPF
FT                   QMTALNGFGSHVTLARQRRWGFWQGQMQFNASEATFNKVDLRRPSATLQADNGTVRVSD
FT                   LSAISQKGLLEASATLNQIDSRLTLALHGRGVPVGQLDTWGWPALSTLQGDITLQLTLR
FT                   APLQADTPFRQGVEATLQAQDAHGHTLHQRMVSGQLVAEASPIAAED"
     MKVIGKLLLT LCVLLLLALA AVYFIGQSRW GARQISDWVN QHTNYRITLS ALQHTLRQPT        60
     VVQVNGFSLA RAGQPPLLQS ATLRLTFGWQ QLSAPRHFSA IGLSGGKLTL TQDGIPPLPI       120
     SAAALRLHDM QILWPHADWP LQASDVDGGI VPLRPGSAKA DFQFSATALS IGDIPAKNVL       180
     VQGEYRDRQL WLNNLGADVA NGQMTAQALR QTDGTWRIDN LRLSQIHWQS SQALQPFLHA       240
     LQILPPLTLV RLDLLGANLE GKGWALGGLD ATLRNVSLAN GHWRSQKGSL TLNATDIVLG       300
     AMHLSDPLLS ADLTPQGVTL RQFNTRWSNA LIRTHGDWQR DNGHLTLNDL AVIGLEYTLP       360
     NAWRTLWLHP LPTWLQEITL QRFSLSRTLL VDINPDFPFQ MTALNGFGSH VTLARQRRWG       420
     FWQGQMQFNA SEATFNKVDL RRPSATLQAD NGTVRVSDLS AISQKGLLEA SATLNQIDSR       480
     LTLALHGRGV PVGQLDTWGW PALSTLQGDI TLQLTLRAPL QADTPFRQGV EATLQAQDAH       540
     GHTLHQRMVS GQLVAEASPI AAED                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page