(data stored in ACNUC7421 zone)

EMBL: CP001600.PE250

CP001600.PE250       Location/Qualifiers
FT   CDS             282053..283672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0278"
FT                   /product="periplasmic oligopeptide-binding protein
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67520"
FT                   /db_xref="GOA:C5BCR3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR3"
FT                   /protein_id="ACR67520.1"
FT                   /translation="MNIKYNLFLGYGLFMLIFGMGPSGGALAASVAPGVTLAAGQTLTR
FT                   NNGSEPASLDPHKSESDVEFNIINDFFEGLVTMGPDGHIRPGLAERWENSEDGRIWRLY
FT                   LRPGLQWSNGEPLTARDVVFSWQRQVDPATASPYGSYLANMHLENAIQIQAGQQPPEAL
FT                   GIRAVDDVTLQITLTRPLSTFLSMLVHPSLMTVNPRVIARFGDKWTQPGNFVSSGAYTL
FT                   QRWVVNERLEGVRNPRYWDNAHTVINQVTYLPIVSETADVNRYKAGEIDITASVPSPQF
FT                   AALRRELGEQVHIAPKLATYYYYFNTRKPPFDDPRVRLALNLGLDKDVIADKVLGQGQR
FT                   PAWLFSAGKIGGMTLLPPEYAAWPREQRLARARALLTEAGFGPDSPLHFTLLYNTSEGH
FT                   QRIAIAASSMWKKNLGVEAALNNQEWKTMLDTMRSGNFDLVRSGWVADYDDPSAFLNTF
FT                   RSADSNNTPQYVNPRYDALLAGAADSQDPEKRQQLFQQAETILAAEVPAIPLYHYVSVR
FT                   LVKPHVGGFRAANKTVQQSASR"
     MNIKYNLFLG YGLFMLIFGM GPSGGALAAS VAPGVTLAAG QTLTRNNGSE PASLDPHKSE        60
     SDVEFNIIND FFEGLVTMGP DGHIRPGLAE RWENSEDGRI WRLYLRPGLQ WSNGEPLTAR       120
     DVVFSWQRQV DPATASPYGS YLANMHLENA IQIQAGQQPP EALGIRAVDD VTLQITLTRP       180
     LSTFLSMLVH PSLMTVNPRV IARFGDKWTQ PGNFVSSGAY TLQRWVVNER LEGVRNPRYW       240
     DNAHTVINQV TYLPIVSETA DVNRYKAGEI DITASVPSPQ FAALRRELGE QVHIAPKLAT       300
     YYYYFNTRKP PFDDPRVRLA LNLGLDKDVI ADKVLGQGQR PAWLFSAGKI GGMTLLPPEY       360
     AAWPREQRLA RARALLTEAG FGPDSPLHFT LLYNTSEGHQ RIAIAASSMW KKNLGVEAAL       420
     NNQEWKTMLD TMRSGNFDLV RSGWVADYDD PSAFLNTFRS ADSNNTPQYV NPRYDALLAG       480
     AADSQDPEKR QQLFQQAETI LAAEVPAIPL YHYVSVRLVK PHVGGFRAAN KTVQQSASR        539
//

If you have problems or comments...

PBIL Back to PBIL home page