(data stored in ACNUC7421 zone)

EMBL: CP001600.PE251

CP001600.PE251       Location/Qualifiers
FT   CDS             complement(283638..284039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0277"
FT                   /product="transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67519"
FT                   /db_xref="GOA:C5BG24"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C5BG24"
FT                   /protein_id="ACR67519.2"
FT                   /translation="MERQGIPLAVLVSGANRHDSIMFEPLLDALPALAGKRGRPRYRPD
FT                   KLHADKGYDFRRCRDYLRRRGIKARIARRGIDSNDRLGRYRWVVERTHGWLAGFGKLRI
FT                   RFERRLDTHLALLTLACAVICLRFVERFC"
     MERQGIPLAV LVSGANRHDS IMFEPLLDAL PALAGKRGRP RYRPDKLHAD KGYDFRRCRD        60
     YLRRRGIKAR IARRGIDSND RLGRYRWVVE RTHGWLAGFG KLRIRFERRL DTHLALLTLA       120
     CAVICLRFVE RFC                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page