(data stored in ACNUC7421 zone)

EMBL: CP001600.PE255

CP001600.PE255       Location/Qualifiers
FT   CDS             complement(286691..287245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0282"
FT                   /product="YGGT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67524"
FT                   /db_xref="GOA:C5BCR8"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR8"
FT                   /protein_id="ACR67524.1"
FT                   /translation="MLTLTFLVKTLLDLYVMVLLLRIWMQWARSDFYNPLSQFIVKLTQ
FT                   PVVAPLRRILPPLGPIDSASLLLAFILMTVKYPLLLLIQSGSLSLSPYNLLFGLISVVK
FT                   SAGYLVFWVIIIRSIMSWISQGRSPMDYVLYQLSEPLMAPIRRIIPAMGGLDFSAMVVI
FT                   LVLYLLNYLGIDLFGQLWFLL"
     MLTLTFLVKT LLDLYVMVLL LRIWMQWARS DFYNPLSQFI VKLTQPVVAP LRRILPPLGP        60
     IDSASLLLAF ILMTVKYPLL LLIQSGSLSL SPYNLLFGLI SVVKSAGYLV FWVIIIRSIM       120
     SWISQGRSPM DYVLYQLSEP LMAPIRRIIP AMGGLDFSAM VVILVLYLLN YLGIDLFGQL       180
     WFLL                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page