(data stored in ACNUC7421 zone)

EMBL: CP001600.PE256

CP001600.PE256       Location/Qualifiers
FT   CDS             complement(287351..288061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0283"
FT                   /product="alanine racemase, N-terminal domain protein"
FT                   /note="alanine racemase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67525"
FT                   /db_xref="GOA:C5BCR9"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR9"
FT                   /protein_id="ACR67525.1"
FT                   /translation="MNTTIKHNLDAVRQHIARAAEQCGRHPRDITLLAVSKTKPIEDID
FT                   AAIAAGQRAFGENYVQEGVSKIQHYRQQPQGDALEWHFIGPLQSNKSRPVAEHFDWIHT
FT                   VDRVKIAQRLNEQRPAQLKPLNVLIQVNISDEQSKSGITLEQIDALADAISQLPRLRLR
FT                   GLMAIPAPEDDPARQLAVCTRMAQALSALQRRYPQLDTLSLGMTHDMEAAITAGSTLVR
FT                   IGTAIFGARDYGTA"
     MNTTIKHNLD AVRQHIARAA EQCGRHPRDI TLLAVSKTKP IEDIDAAIAA GQRAFGENYV        60
     QEGVSKIQHY RQQPQGDALE WHFIGPLQSN KSRPVAEHFD WIHTVDRVKI AQRLNEQRPA       120
     QLKPLNVLIQ VNISDEQSKS GITLEQIDAL ADAISQLPRL RLRGLMAIPA PEDDPARQLA       180
     VCTRMAQALS ALQRRYPQLD TLSLGMTHDM EAAITAGSTL VRIGTAIFGA RDYGTA           236
//

If you have problems or comments...

PBIL Back to PBIL home page