(data stored in ACNUC7421 zone)

EMBL: CP001600.PE258

CP001600.PE258       Location/Qualifiers
FT   CDS             complement(288668..289201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0285"
FT                   /product="hypothetical protein"
FT                   /note="Uncharacterized ACR, COG1678"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67527"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS1"
FT                   /protein_id="ACR67527.1"
FT                   /translation="MPAMQDSRFKRTVIYVCEHNEDGAMGMIINKPLEQLTLSSLLEKL
FT                   DITPSPRDATIRLDKPVLAGGPLAEDRGFVLHSPTDTFGSSADIGPGCMLTTSRDVLET
FT                   LGTDRQPQEILVTLGYCSWSKGQLEQELLDNTWLTVEADSQILFHTPLAERWIGAAKKL
FT                   GVDIRNMPCNAGHA"
     MPAMQDSRFK RTVIYVCEHN EDGAMGMIIN KPLEQLTLSS LLEKLDITPS PRDATIRLDK        60
     PVLAGGPLAE DRGFVLHSPT DTFGSSADIG PGCMLTTSRD VLETLGTDRQ PQEILVTLGY       120
     CSWSKGQLEQ ELLDNTWLTV EADSQILFHT PLAERWIGAA KKLGVDIRNM PCNAGHA          177
//

If you have problems or comments...

PBIL Back to PBIL home page