(data stored in ACNUC7421 zone)

EMBL: CP001600.PE263

CP001600.PE263       Location/Qualifiers
FT   CDS             293003..294322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0290"
FT                   /product="basic amino acid/polyamine antiporter (APA)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67532"
FT                   /db_xref="GOA:C5BCS6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS6"
FT                   /protein_id="ACR67532.1"
FT                   /translation="MASVKKIGLIACTGVVAGNMMGSGIALLPANLASLGSIAVWGWLI
FT                   ALVGAVSLAYVYARLATKNPQEGGPVAYAGEVGAAFGFQTGVLYYHANWIGNLAIGITA
FT                   ISYLSTFFPVLNSPVPAGIACIAIVWIFTFVNMLGGAWVSRLTTLGLVLVLIPVIGTGI
FT                   AGWFWFEPATYMANWNTSGGTDYHAVIKSILLCLWAFIGVESASVSTGMVKDPQRNVPL
FT                   ATMMGTFLAGIVYIAATQAIAGMYPAHQMAASGAPFAISASTMVGSWAGPVVSAFTAFA
FT                   CLTSLGSWMMLVSQAGARAAHDGNFPKIYGELDKNGLPKKGLFLAAIKMTILMVLITVM
FT                   NASGDKASDLFGELTGIAVLLTMLPYFYSCIDLIRFDGANIKNVLSLLASILGCVFCFI
FT                   ALMGANSIELSGTFIVSLIILMFYSRKLGSTQDKDNAPRN"
     MASVKKIGLI ACTGVVAGNM MGSGIALLPA NLASLGSIAV WGWLIALVGA VSLAYVYARL        60
     ATKNPQEGGP VAYAGEVGAA FGFQTGVLYY HANWIGNLAI GITAISYLST FFPVLNSPVP       120
     AGIACIAIVW IFTFVNMLGG AWVSRLTTLG LVLVLIPVIG TGIAGWFWFE PATYMANWNT       180
     SGGTDYHAVI KSILLCLWAF IGVESASVST GMVKDPQRNV PLATMMGTFL AGIVYIAATQ       240
     AIAGMYPAHQ MAASGAPFAI SASTMVGSWA GPVVSAFTAF ACLTSLGSWM MLVSQAGARA       300
     AHDGNFPKIY GELDKNGLPK KGLFLAAIKM TILMVLITVM NASGDKASDL FGELTGIAVL       360
     LTMLPYFYSC IDLIRFDGAN IKNVLSLLAS ILGCVFCFIA LMGANSIELS GTFIVSLIIL       420
     MFYSRKLGST QDKDNAPRN                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page