(data stored in ACNUC7421 zone)

EMBL: CP001600.PE266

CP001600.PE266       Location/Qualifiers
FT   CDS             complement(297783..298460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0293"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67535"
FT                   /db_xref="InterPro:IPR009576"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS9"
FT                   /protein_id="ACR67535.1"
FT                   /translation="MKRTKHINRSAFRKRWQMAPLALAVSAVFLLAGCEKSDETVSLYQ
FT                   NADDCSKANPSMSAQCKASYDDALKEAAKTAPKYATREDCIAEFGEGQCTQTPAQAGMA
FT                   PTTGNTNAEAAQSSGSFWMPLMAGYMMGRLMGGGFNQQPLFTPRGAASPANGQFVDASG
FT                   KSYGPATAGGRTMNVPKTAMAPKPATTTTVTRGGFGETVAKQSSLQRSSASGTGTSSRS
FT                   MGG"
     MKRTKHINRS AFRKRWQMAP LALAVSAVFL LAGCEKSDET VSLYQNADDC SKANPSMSAQ        60
     CKASYDDALK EAAKTAPKYA TREDCIAEFG EGQCTQTPAQ AGMAPTTGNT NAEAAQSSGS       120
     FWMPLMAGYM MGRLMGGGFN QQPLFTPRGA ASPANGQFVD ASGKSYGPAT AGGRTMNVPK       180
     TAMAPKPATT TTVTRGGFGE TVAKQSSLQR SSASGTGTSS RSMGG                       225
//

If you have problems or comments...

PBIL Back to PBIL home page