(data stored in ACNUC7421 zone)

EMBL: CP001600.PE267

CP001600.PE267       Location/Qualifiers
FT   CDS             298443..298727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67536"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT0"
FT                   /protein_id="ACR67536.1"
FT                   /translation="MFGPFHDEVPRCGPSKSRARLSQIADSIGESWLHLKRAGAAVAGF
FT                   TYAEAVMCHSSLFRPLTRVTKPLDNARLAGICTGGNPRSAMLREIGLAY"
     MFGPFHDEVP RCGPSKSRAR LSQIADSIGE SWLHLKRAGA AVAGFTYAEA VMCHSSLFRP        60
     LTRVTKPLDN ARLAGICTGG NPRSAMLREI GLAY                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page