(data stored in ACNUC7421 zone)

EMBL: CP001600.PE268

CP001600.PE268       Location/Qualifiers
FT   CDS             complement(298789..299358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0295"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67537"
FT                   /db_xref="GOA:C5BCT1"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT1"
FT                   /protein_id="ACR67537.1"
FT                   /translation="MIYFDRNRLLQLDPRFLKQQRVSLLILSLLLLLGGLFCLFRPLTS
FT                   GDALSAMVGILLLLSGIGLIIGMIANRANNFWPMIGGILMGAAYLVMGFIFIRNPEVGL
FT                   FTVAVLVATLFALGGIARLMAGVKLKGAHGGWLQIIIGLLDLLIAWMLISAGPQGSILL
FT                   VTMIVGIEMLFSSFSLFQVAQLLKQR"
     MIYFDRNRLL QLDPRFLKQQ RVSLLILSLL LLLGGLFCLF RPLTSGDALS AMVGILLLLS        60
     GIGLIIGMIA NRANNFWPMI GGILMGAAYL VMGFIFIRNP EVGLFTVAVL VATLFALGGI       120
     ARLMAGVKLK GAHGGWLQII IGLLDLLIAW MLISAGPQGS ILLVTMIVGI EMLFSSFSLF       180
     QVAQLLKQR                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page