(data stored in ACNUC7421 zone)

EMBL: CP001600.PE270

CP001600.PE270       Location/Qualifiers
FT   CDS             299761..300678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0297"
FT                   /product="Uncharacterized protein family (UPF0187)"
FT                   /note="Uncharacterised protein family (UPF0187)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67539"
FT                   /db_xref="GOA:C5BCT3"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT3"
FT                   /protein_id="ACR67539.1"
FT                   /translation="MIVRPPQHWFRRLFVWHGSVLPNILFRLSLNFMVSCLAVMCYLWH
FT                   EDFNVNLTLGPFSLLGVAIAIFLGFRNNASYARFIEARVLWGSLLITTRSLMRQAISLM
FT                   PHPDGEHRRFAMLLTAFSYALKHHLRHEPMAMELTRLLPSQDKAAVLGSCSPCNRLLQL
FT                   MGQWLGEQRQRGYLSDIDFQTIDTNLNQLSVILGGCERISNTPIPFAYSLIVHRTVYVF
FT                   CALLPFALVSDLHYMTPLVSVFISYTFIALDALAEELEDPFGIEANDLPLNAMAHTIEA
FT                   NLRDMINDHTHLARICPDSHCRLD"
     MIVRPPQHWF RRLFVWHGSV LPNILFRLSL NFMVSCLAVM CYLWHEDFNV NLTLGPFSLL        60
     GVAIAIFLGF RNNASYARFI EARVLWGSLL ITTRSLMRQA ISLMPHPDGE HRRFAMLLTA       120
     FSYALKHHLR HEPMAMELTR LLPSQDKAAV LGSCSPCNRL LQLMGQWLGE QRQRGYLSDI       180
     DFQTIDTNLN QLSVILGGCE RISNTPIPFA YSLIVHRTVY VFCALLPFAL VSDLHYMTPL       240
     VSVFISYTFI ALDALAEELE DPFGIEANDL PLNAMAHTIE ANLRDMINDH THLARICPDS       300
     HCRLD                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page