(data stored in ACNUC7421 zone)

EMBL: CP001600.PE271

CP001600.PE271       Location/Qualifiers
FT   CDS             complement(300779..301417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0298"
FT                   /product="chaperone protein TorD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67540"
FT                   /db_xref="GOA:C5BCT4"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR023069"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT4"
FT                   /protein_id="ACR67540.1"
FT                   /translation="MSAASPLTAQHYACLYAWLAGLFAHETDDAQLARLRSPDTQAWFA
FT                   LLRQLAPLRPALQCLQEALVALEARPDARLELAADFAGLFLLSQKRAALPYASCYQGET
FT                   PRFRQAPCDEVQSLLQRAGMQLNADFHEPEDHLSIFLELLSHLSFASAEQPGQEDVLVP
FT                   LRQRTLALLLEWLPEFNARCLRYDTFGFYAALSQLLLALVRLDANHRAA"
     MSAASPLTAQ HYACLYAWLA GLFAHETDDA QLARLRSPDT QAWFALLRQL APLRPALQCL        60
     QEALVALEAR PDARLELAAD FAGLFLLSQK RAALPYASCY QGETPRFRQA PCDEVQSLLQ       120
     RAGMQLNADF HEPEDHLSIF LELLSHLSFA SAEQPGQEDV LVPLRQRTLA LLLEWLPEFN       180
     ARCLRYDTFG FYAALSQLLL ALVRLDANHR AA                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page