(data stored in ACNUC7421 zone)

EMBL: CP001600.PE275

CP001600.PE275       Location/Qualifiers
FT   CDS             complement(305967..307001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0302"
FT                   /product="TMAO reductase system periplasmic protein TorT ,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67544"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR014301"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT8"
FT                   /protein_id="ACR67544.1"
FT                   /translation="MSRRRTLFLCLLWLSTATAHADAPLLRWQSDRQSVQLRQPPLHAG
FT                   KRWKLCALYPSLKDAYWLSINDGMIRAADRLGVTLKVFDAGGYRQQATQREQMALCRDW
FT                   GADAILIGSSTARFPALATLAAGIPLIGVVNALHDPNIRTRIGVPWFQMGYQPGHYLAQ
FT                   HLGQRPLKVLLMPGPRDAGGSREMSDGFKAALGGSRLQIVEVAYGDNDIEVQRNLLQDM
FT                   LERHPDIDVVAGTAIAAEVAMGEGRNRATPLTIVSFYLSHQVYRGLKRGRILAAASDQM
FT                   VWQGELAVEQALRSLQGERVPDNISPPILVLTQRNVSSAQVRRSLSPLGFRPVYLYQPA
FT                   LKAG"
     MSRRRTLFLC LLWLSTATAH ADAPLLRWQS DRQSVQLRQP PLHAGKRWKL CALYPSLKDA        60
     YWLSINDGMI RAADRLGVTL KVFDAGGYRQ QATQREQMAL CRDWGADAIL IGSSTARFPA       120
     LATLAAGIPL IGVVNALHDP NIRTRIGVPW FQMGYQPGHY LAQHLGQRPL KVLLMPGPRD       180
     AGGSREMSDG FKAALGGSRL QIVEVAYGDN DIEVQRNLLQ DMLERHPDID VVAGTAIAAE       240
     VAMGEGRNRA TPLTIVSFYL SHQVYRGLKR GRILAAASDQ MVWQGELAVE QALRSLQGER       300
     VPDNISPPIL VLTQRNVSSA QVRRSLSPLG FRPVYLYQPA LKAG                        344
//

If you have problems or comments...

PBIL Back to PBIL home page