(data stored in ACNUC7421 zone)

EMBL: CP001600.PE286

CP001600.PE286       Location/Qualifiers
FT   CDS             319468..320340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0314"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67556"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV0"
FT                   /protein_id="ACR67556.1"
FT                   /translation="MKILPVISPKGGEGKSTFAAYLAGFLADAGVKTLLIDADWTQPTV
FT                   SSIFALNKEAPFGLYELLMQTIPDPLQAISQTSIDNLDLIYSNDPDELLPTAMLHAADG
FT                   RIRLRNILQNHEFARYGAIILDSKGATGVMTELSILASTGRVMGVVKPILPDVREFIRG
FT                   SLHMFSRLKTYENYGIHLPDISILVNCFENTLLDREAMDGLSKIISEKLYDSSVLGDRN
FT                   MFSLLDTCIEQLDIFKLGHVKSQPVHRLEYKTRRKGPAAADTMHSLACELFPEWKERFD
FT                   DVLSREVRV"
     MKILPVISPK GGEGKSTFAA YLAGFLADAG VKTLLIDADW TQPTVSSIFA LNKEAPFGLY        60
     ELLMQTIPDP LQAISQTSID NLDLIYSNDP DELLPTAMLH AADGRIRLRN ILQNHEFARY       120
     GAIILDSKGA TGVMTELSIL ASTGRVMGVV KPILPDVREF IRGSLHMFSR LKTYENYGIH       180
     LPDISILVNC FENTLLDREA MDGLSKIISE KLYDSSVLGD RNMFSLLDTC IEQLDIFKLG       240
     HVKSQPVHRL EYKTRRKGPA AADTMHSLAC ELFPEWKERF DDVLSREVRV                  290
//

If you have problems or comments...

PBIL Back to PBIL home page