(data stored in ACNUC7421 zone)

EMBL: CP001600.PE288

CP001600.PE288       Location/Qualifiers
FT   CDS             320690..321487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67558"
FT                   /db_xref="GOA:C5BCV2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV2"
FT                   /protein_id="ACR67558.1"
FT                   /translation="MSYMTINAILAQRPERQPYIDGPEKACCQWQHGVDDRPNNVIVMY
FT                   DEAHGFTVAPVCCRLHTGKSVWRIKPVQFFFNVIPEPCVAGWQIYRPFLCQRNGHFPER
FT                   QFFDIGWQPAVAPDNGIMQGLHGRASVVLNAPVMGPLQPFTQPHQPEFQLPVFRFFLFS
FT                   LTLETLADVVKFTFTHAQKFARQQFAIGIHIFSLCVMNINVLPAPSDQSRQTSWLEIVL
FT                   SVSGIITLAIVCLAPFTFLHGLLVYSAISTVFWQHFHQEVCHG"
     MSYMTINAIL AQRPERQPYI DGPEKACCQW QHGVDDRPNN VIVMYDEAHG FTVAPVCCRL        60
     HTGKSVWRIK PVQFFFNVIP EPCVAGWQIY RPFLCQRNGH FPERQFFDIG WQPAVAPDNG       120
     IMQGLHGRAS VVLNAPVMGP LQPFTQPHQP EFQLPVFRFF LFSLTLETLA DVVKFTFTHA       180
     QKFARQQFAI GIHIFSLCVM NINVLPAPSD QSRQTSWLEI VLSVSGIITL AIVCLAPFTF       240
     LHGLLVYSAI STVFWQHFHQ EVCHG                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page