(data stored in ACNUC7421 zone)

EMBL: CP001600.PE290

CP001600.PE290       Location/Qualifiers
FT   CDS             322847..324511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0318"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67560"
FT                   /db_xref="InterPro:IPR022304"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV4"
FT                   /protein_id="ACR67560.2"
FT                   /translation="MSRNRTNIGASMLQPGRRASGSVESTPVVEMPMVLTIEQLAPNPD
FT                   NPRTSRNSRYDEIKASIKARGLDTVPKVTRDPDGDPNKYIFSDGGNTRYQILTELWQET
FT                   GEERFFRIHVLVKPWPGRLQCVIGHLAENEVRGDLSFIEKAQGIHKARTIYEEQLGKSV
FT                   SLRELSTLLTREGLPVHNSTISRMEDALKHLFPWMPELLESGLGAPQIRLLLALRQDAE
FT                   KVWDQFCLLSERSDKCFTEVFGECCRKFNSPELWSPEMFRDEFIGDLLLALPHPELNYD
FT                   RWMMELDPSERNRRYHFGEPEETTSPQGVVPSPFTDGIQDTAPEPDFALPKALTESPPA
FT                   TPAVTEEWPQQDENLRVSPEDNKEAPLSLPRTEVQPDMYGGSPVISGDGMGPGLSPDND
FT                   ETLISMLAPGLEDEGEALHPACHIAGDAIWSVPAYQDDIEHLQNIAFIMAWELGEKLGC
FT                   EDEILPDRASSLSPGYCAAGDSCSAPAAFLLSLAGCCPAQCPTTGMDVVLIGGSAQQDV
FT                   PVLDDENAIKLLRLMRVMRRLRELQRGVTAVEDEHDE"
     MSRNRTNIGA SMLQPGRRAS GSVESTPVVE MPMVLTIEQL APNPDNPRTS RNSRYDEIKA        60
     SIKARGLDTV PKVTRDPDGD PNKYIFSDGG NTRYQILTEL WQETGEERFF RIHVLVKPWP       120
     GRLQCVIGHL AENEVRGDLS FIEKAQGIHK ARTIYEEQLG KSVSLRELST LLTREGLPVH       180
     NSTISRMEDA LKHLFPWMPE LLESGLGAPQ IRLLLALRQD AEKVWDQFCL LSERSDKCFT       240
     EVFGECCRKF NSPELWSPEM FRDEFIGDLL LALPHPELNY DRWMMELDPS ERNRRYHFGE       300
     PEETTSPQGV VPSPFTDGIQ DTAPEPDFAL PKALTESPPA TPAVTEEWPQ QDENLRVSPE       360
     DNKEAPLSLP RTEVQPDMYG GSPVISGDGM GPGLSPDNDE TLISMLAPGL EDEGEALHPA       420
     CHIAGDAIWS VPAYQDDIEH LQNIAFIMAW ELGEKLGCED EILPDRASSL SPGYCAAGDS       480
     CSAPAAFLLS LAGCCPAQCP TTGMDVVLIG GSAQQDVPVL DDENAIKLLR LMRVMRRLRE       540
     LQRGVTAVED EHDE                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page