(data stored in ACNUC7421 zone)

EMBL: CP001600.PE291

CP001600.PE291       Location/Qualifiers
FT   CDS             324504..325226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0319"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67561"
FT                   /db_xref="InterPro:IPR016868"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV5"
FT                   /protein_id="ACR67561.1"
FT                   /translation="MNNDKRQERLVSLVRKLLELSRSNSNAHEAGLALSRAQRLMEKYG
FT                   ISELDATLSSVRDVASQSAPSEAEKVPEWMTRLAWAVGHAFGCRPYFSWRNTSSGDCRQ
FT                   TVTFYGFSERPAVAAYAFDVLTRQLKDATAVYLKTQSKKLKLSTRRNRAELFRAGWVDG
FT                   MRRVITVFRVTERETQLMTRWMDNQNMKAATIRELKSCRGGDIARHRGYEAGKNARLHH
FT                   GVEGENTAAIGHREERTS"
     MNNDKRQERL VSLVRKLLEL SRSNSNAHEA GLALSRAQRL MEKYGISELD ATLSSVRDVA        60
     SQSAPSEAEK VPEWMTRLAW AVGHAFGCRP YFSWRNTSSG DCRQTVTFYG FSERPAVAAY       120
     AFDVLTRQLK DATAVYLKTQ SKKLKLSTRR NRAELFRAGW VDGMRRVITV FRVTERETQL       180
     MTRWMDNQNM KAATIRELKS CRGGDIARHR GYEAGKNARL HHGVEGENTA AIGHREERTS       240
//

If you have problems or comments...

PBIL Back to PBIL home page