(data stored in ACNUC7421 zone)

EMBL: CP001600.PE292

CP001600.PE292       Location/Qualifiers
FT   CDS             325223..325648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67562"
FT                   /db_xref="GOA:C5BCV6"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV6"
FT                   /protein_id="ACR67562.1"
FT                   /translation="MTKHQRVLLSGTSHCLWCGVVLGLLAADMYPGVVPAFSGAVLRGL
FT                   AVASFISVLLWMMVSYLEDISWTYIWGVMFLPPLAALLLCHVGWLGYSFIFWKWDYDFA
FT                   LFIREAVLPVVFLVWGACNFLIVPFIFLFILSPGGVE"
     MTKHQRVLLS GTSHCLWCGV VLGLLAADMY PGVVPAFSGA VLRGLAVASF ISVLLWMMVS        60
     YLEDISWTYI WGVMFLPPLA ALLLCHVGWL GYSFIFWKWD YDFALFIREA VLPVVFLVWG       120
     ACNFLIVPFI FLFILSPGGV E                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page