(data stored in ACNUC7421 zone)

EMBL: CP001600.PE293

CP001600.PE293       Location/Qualifiers
FT   CDS             325645..326253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0321"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67563"
FT                   /db_xref="InterPro:IPR021364"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV7"
FT                   /protein_id="ACR67563.1"
FT                   /translation="MTNSGGLSQAANGLLMQLVMDLKSGYLRRCESLGIKREEMQMLQG
FT                   LSLEELHYLANSEVSVVSISIDHSNLVSMLQRARMEQKRMQRIDRALALGSSIELMQTF
FT                   FGLSSTDVAARRRIAGIEARSGRGNTLGDEDNAEIWRLWQKSGVEEVESPDGLDVMMLA
FT                   AEQLNIPLTSVWHAVKGWHRTTPRRSVGQSLKPSVRKRA"
     MTNSGGLSQA ANGLLMQLVM DLKSGYLRRC ESLGIKREEM QMLQGLSLEE LHYLANSEVS        60
     VVSISIDHSN LVSMLQRARM EQKRMQRIDR ALALGSSIEL MQTFFGLSST DVAARRRIAG       120
     IEARSGRGNT LGDEDNAEIW RLWQKSGVEE VESPDGLDVM MLAAEQLNIP LTSVWHAVKG       180
     WHRTTPRRSV GQSLKPSVRK RA                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page