(data stored in ACNUC7421 zone)

EMBL: CP001600.PE294

CP001600.PE294       Location/Qualifiers
FT   CDS             326537..327757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0322"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67564"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV8"
FT                   /protein_id="ACR67564.1"
FT                   /translation="MMLPADSLIAFTLEKMNARLVANPLRDAGRVRSGLLFTGNVHDAI
FT                   PRRLLLDPRLSPLDKMGWMMIRLYAQNNEGAIFPSYDELQLQLASPGKGKASRETVSRV
FT                   LLMLRITGWLSLCRRVRDDKGRVRGNIYAQHDEPLTFRDAESLDPRFLDVVADACLSKN
FT                   RTVSQTARGVLDEIKTDPTMRHYHSHLSLLENRLGRPQNAGQLATRQHPSLLTPEQGSG
FT                   SELSVNRTINDHHELSTETELSQNQERIIQSSDSELPVKSGDYDRVRKPNHYVRSFTHS
FT                   VNKKTYVDNPVVLPDALKAVVSQEDQVMLIRQLQALPEELALQVLSALQSQMARRQVDN
FT                   PLGWMLAVMKKAREGAFRPVKQPHPVQFETHEQPLFSASPRPAAASEEQVRNYVNTLRE
FT                   QLRQNTR"
     MMLPADSLIA FTLEKMNARL VANPLRDAGR VRSGLLFTGN VHDAIPRRLL LDPRLSPLDK        60
     MGWMMIRLYA QNNEGAIFPS YDELQLQLAS PGKGKASRET VSRVLLMLRI TGWLSLCRRV       120
     RDDKGRVRGN IYAQHDEPLT FRDAESLDPR FLDVVADACL SKNRTVSQTA RGVLDEIKTD       180
     PTMRHYHSHL SLLENRLGRP QNAGQLATRQ HPSLLTPEQG SGSELSVNRT INDHHELSTE       240
     TELSQNQERI IQSSDSELPV KSGDYDRVRK PNHYVRSFTH SVNKKTYVDN PVVLPDALKA       300
     VVSQEDQVML IRQLQALPEE LALQVLSALQ SQMARRQVDN PLGWMLAVMK KAREGAFRPV       360
     KQPHPVQFET HEQPLFSASP RPAAASEEQV RNYVNTLREQ LRQNTR                      406
//

If you have problems or comments...

PBIL Back to PBIL home page