(data stored in ACNUC7421 zone)

EMBL: CP001600.PE295

CP001600.PE295       Location/Qualifiers
FT   CDS             327765..328916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0323"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67565"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV9"
FT                   /protein_id="ACR67565.1"
FT                   /translation="MCSVASSNSGTKNVRCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQ
FT                   WLKNAQCWRCQQRLKNAQRWHCQQRLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQ
FT                   QWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWRC
FT                   QQRLKNAQCWHCQQRLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWR
FT                   CQQRLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWRCQQRLKNAQCW
FT                   HCQQWLKNAQCWHCQQWLKNAQCWRCQQRLKNAQCWHCQQRLKNAQCWHCQQWLKNAQC
FT                   WHCQQRLKNVLCLLAMDKSKFHHLAIWFSIVLLPLAADYLNPD"
     MCSVASSNSG TKNVRCWHCQ QWLKNAQCWH CQQWLKNAQC WHCQQWLKNA QCWRCQQRLK        60
     NAQRWHCQQR LKNAQCWHCQ QWLKNAQCWH CQQWLKNAQC WHCQQWLKNA QCWHCQQWLK       120
     NAQCWHCQQW LKNAQCWHCQ QWLKNAQCWH CQQWLKNAQC WRCQQRLKNA QCWHCQQRLK       180
     NAQCWHCQQW LKNAQCWHCQ QWLKNAQCWH CQQWLKNAQC WRCQQRLKNA QCWHCQQWLK       240
     NAQCWHCQQW LKNAQCWHCQ QWLKNAQCWR CQQRLKNAQC WHCQQWLKNA QCWHCQQWLK       300
     NAQCWRCQQR LKNAQCWHCQ QRLKNAQCWH CQQWLKNAQC WHCQQRLKNV LCLLAMDKSK       360
     FHHLAIWFSI VLLPLAADYL NPD                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page