(data stored in ACNUC7421 zone)

EMBL: CP001600.PE296

CP001600.PE296       Location/Qualifiers
FT   CDS             328943..329698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0324"
FT                   /product="Protein of unknown function (DUF1845)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67566"
FT                   /db_xref="InterPro:IPR014996"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW0"
FT                   /protein_id="ACR67566.1"
FT                   /translation="MEKGKKNADAKVGNEASSPRAGALQSALSVELHTHYASRLWEGRK
FT                   QSDSDSRSHHEKKRPEIISMPKAIQRAGIASRDSASDNPYADAVLLKLENAINAASTKV
FT                   SKTLNELDAILGGVPNGITLSDIASAHPLNISIYSRSPLGYRCVWLLVGYDQLAMKAFQ
FT                   AFHYGLISRAQRDQYLNRGGHAVRQVYGAIQPYYTVTVNRSDIINLTARGQEALARLGE
FT                   PDPDIFSGKKRSSFSSPLREKPVSQSEKS"
     MEKGKKNADA KVGNEASSPR AGALQSALSV ELHTHYASRL WEGRKQSDSD SRSHHEKKRP        60
     EIISMPKAIQ RAGIASRDSA SDNPYADAVL LKLENAINAA STKVSKTLNE LDAILGGVPN       120
     GITLSDIASA HPLNISIYSR SPLGYRCVWL LVGYDQLAMK AFQAFHYGLI SRAQRDQYLN       180
     RGGHAVRQVY GAIQPYYTVT VNRSDIINLT ARGQEALARL GEPDPDIFSG KKRSSFSSPL       240
     REKPVSQSEK S                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page