(data stored in ACNUC7421 zone)

EMBL: CP001600.PE298

CP001600.PE298       Location/Qualifiers
FT   CDS             332392..332856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0326"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67568"
FT                   /db_xref="InterPro:IPR021960"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW2"
FT                   /protein_id="ACR67568.1"
FT                   /translation="MSANNPASGKTEYFNLTIKGLGYLSNIRQVNLQNGSFLSCVINAL
FT                   SGPTDNPVYVRFDVSVAGKEATSLIGRCQKAVDEDKKVLIGFTLSNPSTDIFTLNKGDH
FT                   AGEQRVSLKARLIKVDWIKIGQDMVYKTEKPDSMPPQNSSAQPEYAENSF"
     MSANNPASGK TEYFNLTIKG LGYLSNIRQV NLQNGSFLSC VINALSGPTD NPVYVRFDVS        60
     VAGKEATSLI GRCQKAVDED KKVLIGFTLS NPSTDIFTLN KGDHAGEQRV SLKARLIKVD       120
     WIKIGQDMVY KTEKPDSMPP QNSSAQPEYA ENSF                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page