(data stored in ACNUC7421 zone)

EMBL: CP001600.PE299

CP001600.PE299       Location/Qualifiers
FT   CDS             332934..333137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0327"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67569"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW3"
FT                   /protein_id="ACR67569.1"
FT                   /translation="MNNSTGILAAESGFTLPLQVLKSGRGYYIGTANHEGPVSRESEEY
FT                   FNSHKKVVQAFTTVAWTQREWA"
     MNNSTGILAA ESGFTLPLQV LKSGRGYYIG TANHEGPVSR ESEEYFNSHK KVVQAFTTVA        60
     WTQREWA                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page